<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1503 CA20072 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDC 104
3 NRTI 173
4 D4T 30
5 D4T+ DDI 26
6 SQV+ DDI+ D4T 26
7 IDV+ D4T+ 3TC 17
8 NVP+ D4T+ 3TC 4
9 NFV+ AZT+ 3TC 53
10 NFV+ D4T+ 3TC 28
11 D4T+ 3TC 74

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, M184V, T215Y D67G     E44D, S68G, K102Q, K103R, K122E, D123DN, I135V, S162C, G196E, T286A, I293V, P294Q, E297R  
>CA20072| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVQLTREAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005