<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7983 CA20070 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI+IDV 222
2 3TC+D4T+NFV+NVP 13
3 3TC+DDI+IDV 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106A F227L K122E, D123N, I135T, I178IM, G196E, T200I, V245VL, T286A Q258QH, N265ND
>CA20070| codons 1-286
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPILLPEKDSWTVNDIHKLVGKLDWASQIYAGIKVKQLCKLLRGA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I13V, K14R, I15V, N37D, K45R, Q61E, I62V, L63P, I66L, A71T, I72R, V77I, I93L  
>CA20446| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADDTVLEEMDLPGRWKPRMIGGIGGFIKVRQYD
EVPIELCGHKTRSTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005