<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7982 CA20069 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+AZT+IDV 17
3 3TC+D4T+RTV+SQV 82
4 EFV+3TC+D4T+RTV+SQV 56
5 EFV+3TC+ABC+D4T+RTV+SQV 21
6 None 17
7 EFV+3TC+ABC+APV+RTV 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E Y188L   T39A, V118I, K122E, I135T, S162C, G196E, L210M, R211RK, F214L, K281R, T286A, P294T, E297R  
>CA20069| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIEQHRTKIEELRQHLMKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTEVITLTRE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L10F, L33LF, N83D T12S, K20R, E34K, E35D, M36I, R41K, I62V, L63P, A71V R8Q
>CA20462| codons 1-99
PQITLWQQPFVSIKIGGQLREALLDTGADDTVFKDINLPGKWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVIGTVLVGPTPVDVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005