<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7963 CA20040 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 78
2 D4T 17
3 3TC+AZT 17
4 3TC+AZT+RTV 8
5 3TC+AZT+IDV 13
6 3TC+AZT+SQV 26
7 3TC+D4T+RTV 25
8 3TC+D4T+NFV 170

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219Q     E6D, V35IM, E44D, D123DE, S162A, D177E, V179VI, G196E, E203D, H208Y, R211K, D218E, K277R, R284RK, I293V, E297A  
>CA20040| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIEQHRTKIDELRQYLWKWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGTKALTEVVPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, L90M K43T L63A, A71T, V77I R8R*
>CA20433| codons 1-99
PQITLWQ*PLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKIIGGIGGFIKVRQYD
QIAIEICGHKTIGTVLIGPTPFNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005