<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7952 CA20027 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 217
2 D4T+DDI 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210LW, T215Y       T39A, K49E, V60I, T69S, K102KQ, D123DE, I135IT, I142KR, E169D, T200A, R211K, A272AG, T286A, E297K  
>CA20027| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISEIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGRRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, I62IV, L63S, I72IV  
>CA20420| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVSIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009