<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1590 CA20013 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 AZT+DDC+IDV 26
3 D4T+DDC+IDV 52
4 3TC+DDI+RTV+SQV 22
5 D4T+DDI+IDV+NFV 58
6 ABC+APV+NVP+RTV 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219N Y181C, M230L   E44D, V60I, V118I, K122E, I135T, G196E, T200I, E203K, Q207D, H208Y, R211K, K223E, A272P A299AG
>CA20013| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRIKIKELRDYLWKWGFYTPDNKHQEEPPFLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82L, L90M L33F, G73T, L89V L10I, T12E, L19I, M36I, R41K, L63P, A71V, V77I, I93L G68GR
>CA20406| codons 1-99
PQITLWQRPIVEIKIGGQIKEALLDTGADDTVFEEINLPGKWKPKIIGGVGGFVKVRQYD
QIPIEICRHKVITTVLIGPTPLNIIGRNVMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005