<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7933 CA20000 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 183
2 3TC+AZT+IDV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98G E6D, K11R, K20KR, R83RK, I135L, K166R, T200E, I202V, R211K, A272P, K277R, T286A, I293V, E297K, R356K, G359S, V365I, A400S, D460N, V467I, Q524E  
>CA20000| codons 1-560
PISPIDTVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHREKVEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDIKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWESWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VAIT   M36I, I62V, L63P  
>CA20393| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005