<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C   V35T, T39G, W88WC, K122P, S162A, K173A, D177E, T200A, Q207E, R211K, F214L, L228R, V245Q, E248D, D250E, K277R, T286A, E291D, V292I, I293V, S322T, R356K, M357K, R358G, G359S, E370G, I375V, T377R, V381I, K390R, E399D, T403M, E432D  
>08TG.T3073| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICGEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKGSA
HTNDVKQLTGAVQKVARESIIIWGKTPKFRLPIQKETWDAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, M36I, R41K, C67Y, H69K, L89M  
>08TG.T3073| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dagnra, AY High prevalence of HIV-1 drug resistance among patients on first-line antiretroviral treatment in Lome, Togo. J Int AIDS Soc, 2011