<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14T, L19P, K20I, M36I, N37S, P39Q, R41RK, R57RK, H69K, K70R, V77I, L89M  
>08TG.T3041| codons 1-99
PQITLWQRPLVTVTIGGQPIEALLDTGADDTVLEEISLQGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   V35T, V60I, S68G, K122E, I135V, S162A, K173I, Q174K, D177E, T200A, Q207G, R211N, T286A, I293V, P294T, E312D, I326V, Q334M, G335D, M357R, G359T, V365I, T369V, A371V, I375V, A376V, T386TA, A400T, T403M, W410Y, E432D M16MK, I31IK
>08TG.T3041| codons 1-434
PISPIETVPVKLKPGKDGPKVKQWPLTEEKKKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELRGHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGMDQWTYQIYQEPFKNLKTGKYARRRTA
HTNDIKQLVEVVQKVVTESIVIWGKAPKFKLPIQKETWETWWMEYWQATYIPEWEFVNTP
PLVKLWYQLEKDPI

References
Author Title Citation
Dagnra, AY High prevalence of HIV-1 drug resistance among patients on first-line antiretroviral treatment in Lome, Togo. J Int AIDS Soc, 2011