<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12A, I13A, K14R, I15IV, G16GE, K20I, M36I, R41K, I62V, L63H, H69K, L89I  
>08TG.T3017| codons 1-99
PQITLWQRPLIAARVEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVHIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN A98AG, K238N V35T, E40D, D123E, S162A, K173T, Q174K, D177E, T200A, Q207E, V245T, D250E, K275R, V276I, T286A, E291D, I293V, P294T, H315Y, S322A, G335D, R356K, M357K, G359S, T369TAIV, A371V, I375A, K390R, T403M, E404D, E432D  
>08TG.T3017| codons 1-432
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDNWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYAGIRIKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVYGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLVEVVQKAATESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKD

References
Author Title Citation
Dagnra, AY High prevalence of HIV-1 drug resistance among patients on first-line antiretroviral treatment in Lome, Togo. J Int AIDS Soc, 2011