<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 96
2 AZT+DDI 13
3 AZT 126
4 3TC+AZT 391

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R, M184V K219KQ     K20KR, V21VI, V35T, V60I, K101R, K103KR, I135IATV, E138ED, K166R, T200A, Q207QH, F214FL, E248D, D250DN, A272S, A288AT, I293V, K347Q, R356K, G359S, A360T, A376AT, K390R Q269QH
>1765695| codons 1-399
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNDTPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRHHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKNSWTVNDIQKLVGKLNWASHIYSGIKVKQLCKLLRGTKTLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFQNLKTGKYAKMRST
HTNDVKQLTEAVQKITTESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, L63P, V77I, I93L  
>1765695| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
von Wyl, V HIV-1 reverse transcriptase connection domain mutations: dynamics of emergence and implications for success of combination antiretroviral therapy. Clin Infect Dis, 2010