<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 196
2 AZT+DDC 35
3 3TC+AZT 365

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       T69S, Q174H, Q207R, R211E, F214FL, V245T, I257L, V261I, V317A, S322T, I329L, Q334N, T338S, M357MI, A360V, A376V, T386A, E399ED  
>1256808| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRRHLLEWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDLQKLIGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPTKDLIAELQKQGNGQWSYQIYQEPFKNLKTGKYARIRGV
HTNDVKQLTEAVQKIVTESIVIWGKAPKFKLPIQKETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19LI, E35D, N37S, K43KR, I62V, L63P, A71AV, V77I, I93L  
>1256808| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
von Wyl, V HIV-1 reverse transcriptase connection domain mutations: dynamics of emergence and implications for success of combination antiretroviral therapy. Clin Infect Dis, 2010