<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 10
2 None 25
3 3TC+D4T+NVP 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KN, I15V, L19T, E35D, M36I, N37D, L63T, H69K, T74A  
>70102373| codons 1-85
PQITLWQRPLVSINVGGQTKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGAVLVGPTPVNII

References
Author Title Citation
Luebbert, J Virological failure and drug resistance in patients on antiretroviral therapy after treatment interruption in Lilongwe, Malawi. Clin Infect Dis, 2012