<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101P, K103NS   I5V, K11A, K20R, E28K, K32E, V35T, T39K, D121Y, K122E, D123G, I135T, S162SC, E169D, K173A, Q174K, D177E, D192DN, G196E, Q207A, R211RS, V245Q, D250E, S251C, T286A, E291D, I293V, E312D, V317VA, D324E V111VG
>CIRCB-10552| codons 1-331
PISPVETVPVALKPGMDGPRVKQWPLTKEKIEALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKSKSVTVLDGGDAYFSVPL
YEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPEIVI
YQYVDDLYVGSNLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKECWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKDPVHGAYYDPSKELIAEIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35N, M36I, N37D, R41K, I62IV, L63PS, H69K, K70R, L89M  
>CIRCB-10552| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011