<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N K103KN, G190A K101H K11T, K20KR, V35T, T39TA, E44D, V118I, K122E, D123N, S162SN, K173AT, D177E, T200K, Q207A, R211NS, V245L, A272P, K277R, L283I, A288T, I293V, P294A, L295LM, E312D  
>CIRCB-10536| codons 1-320
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTQNPEIVI
YQYVDDLYVASDLEIGQHRKKIEELRAHLWSWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKTLTEVVAMTEEAE
LELAENREILKDPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16A, K20KR, E35D, M36I, N37D, R41K, E65D, H69K, V82VI, L89M  
>CIRCB-10536| codons 1-99
PQITLWQRPLVTVKIAGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIDICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011