<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CIRCB-7842 CIRCB-7842 Cameroon 2009 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K101KE, Y181YC, G190A   K20R, E28EK, V35T, T39S, E40ED, E44ED, S48T, K49R, K122E, D123N, K173S, Q174K, V179I, T200A, E203D, Q207N, H208HY, R211K, H221Y, V245M, E291D, I293V, P294T, G335D  
>CIRCB-7842| codons 1-340
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALTEICSDLEKDGKITRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIII
CQYVDDLYVASDLEIGQHRAKIDELRNYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, R57K, D60E, L63P, H69K, V77I, L89M  
>CIRCB-7842| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011