<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CIRCB-10996 CIRCB-10996 Cameroon 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, L19K, K20I, M36I, P39PS, R41N, H69K, L89M  
>CIRCB-10996| codons 1-99
PQITLWQRPLVTVRIGGQKIEALLDTGADDTVFEEINLSGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, V35T, T39A, K104R, K122E, D123G, S162A, K173A, Q174K, D177E, T200A, Q207E, R211RK, F214L, V245Q, V276I  
>CIRCB-10996| codons 1-285
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRG

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011