<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CIRCB-10232 CIRCB-10232 Cameroon 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14Q, G17E, K20I, E34KT, E35D, M36I, R41RK, R57K, Q61H, L63I, I64M, H69C, K70R, I72E, P79PL, L89M  
>CIRCB-10232| codons 1-99
PQITLWQRPLVTVQIGEQLIEALLDTGADDTVLTDINLPGKWKPKMIGGIGGFIKVKQYD
HIIMEICGCRAEGTVLVGLTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, I5IV, K20R, V35IMT, E44ED, K102KQ, K103R, V118I, I135V, S162C, K173IM, Q174K, Q207E, R211K, F214L, V245Q, P247L, E248D, D250E, A272P, K277KR, T286A, E291D, V292I, I293V, E297K, V317VA  
>CIRCB-10232| codons 1-333
PISSVETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRMKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLLDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQG

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011