<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CIRCB-12062 CIRCB-12062 Cameroon 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, L19I, K20I, E35K, M36I, R41K, K43R, H69K, L89M  
>CIRCB-12062| codons 1-99
PQITLWQRPLVTVKIEGQIIEALLDTGADDTVLEKINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, D123E, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245K, V276I, T286A, E291D, V292I, I293V, P294T, S322A, I326V, G335D E79E*
>CIRCB-12062| codons 1-339
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFR*LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTY

References
Author Title Citation
Fokam, J Drug resistance among drug-naive and first-line antiretroviral treatment-failing children in Cameroon. Pediatr Infect Dis J, 2011