<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5718 CA19952 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV 35
3 D4T+DDI+NFV 91
4 3TC+ABC+APV+EFV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, T215Y A62V, D67E G190S   K122E, I142V, D177E, L228H, T286A, E297K  
>CA19952| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKESSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A, L90M L10F I15L, L19I, K20R, E35D, M36I, L63P, I64V, A71V, I93IL  
>CA20345| codons 1-99
PQITLWQRPFVTIKLGGQIREALLDTGADDTILEDINLPGRWKPKLIGGIGGFIKVRQYD
QIPVEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012