<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7896 CA19951 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 100
2 3TC+D4T 87
3 3TC+D4T+NVP 13
4 3TC+D4T 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39A, K43KE, A98S, K122E, D123DN, I142V, K166KR, G196E, R211RK, L228LH, V245EK, A272P, T286A  
>CA19951| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009