<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225PH V35T, V60I, D121H, K122E, I135ILM, K173R, D177E, I178M, T200I, Q207E, R211K, T215X, P243T, V245E, D250E, A272P, K277R, L282C, L283I, I293V, E297K  
>J0594-1| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPEMVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFXTPDKKHQKEHPFLWMGYELHPDKWT
VQTIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGTKALTEVVPLTKEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, K45R, I64V, I72V  
>J0594-1| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QILVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Reynolds, SJ Antiretroviral drug susceptibility among HIV-infected adults failing antiretroviral therapy in Rakai, Uganda. ARHR, 2012