<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V   K101KEQ, Y181C V108I I31IL, L34LI, V35T, E40D, K49R, V60I, D121H, K122E, E169D, D177E, I178M, G196E, T200I, E204EK, Q207D, R211K, V245K, D250E, K277R, L282C, L283I, A288S, I293V, E297A T286I
>E0580-1| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKAITEICTDMEKEGKISRIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEMVI
CQYVDDLYVGSDLEIEQHRIKIEKLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKCIRGIKSLTEVVPLTAEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, R41K, R57K, L63P, I64V, H69Y, I72V  
>E0580-1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYD
QIPVEICGYKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Reynolds, SJ Antiretroviral drug susceptibility among HIV-infected adults failing antiretroviral therapy in Rakai, Uganda. ARHR, 2012