<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC_TDR-353759 RCC_TDR-353759 Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, I62V, L63S, I64V, E65D, H69Y  
>RCC_TDR-353759| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVSVDICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K43R, V60I, D121Y, K122E, I142V, E169D, D177E, E194D, Q197K, T200I, Q207E, R211K  
>RCC_TDR-353759| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLDIGKHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012