<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC_TDR-482974 RCC_TDR-482974 Uganda 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36L, R41K, H69Q, L89I  
>RCC_TDR-482974| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, E36D, T39R, K43Q, K122E, D123N, K173S, D177G, V179I, T200V, I202V, Q207A  
>RCC_TDR-482974| codons 1-242
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTDICREMEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPGIII
YQYMDDLYVGSDLEIGQHRVKVEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012