<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC-TDR-359889 RCC-TDR-359889 Uganda 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, G51GE, L63A, I64V W42W*
>RCC-TDR-359889| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGK*KPKMIGGIEGFIKVRQYD
QIAVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, K49R, V60I, D121Y, K122E, D123E, E138A, I142IV, T165I, E169D, D177E, I178M, R199RK, T200K, Q207E, R211K  
>RCC-TDR-359889| codons 1-242
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMIKILDPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHKKKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012