<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC_TDR_359989 RCC_TDR_359989 Uganda 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I13V, E35D, M36I, R41K, L63M, H69K, L89M  
>RCC_TDR_359989| codons 1-99
PQITLWQRPLVIVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIMIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, V60I, K122E, D123S, I135T, K173L, Q174K, V179I, I202V, Q207A, R211S  
>RCC_TDR_359989| codons 1-242
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPDIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012