<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC_TDR_828529 RCC_TDR_828529 Uganda 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16E, E35N, M36I, P39S, R41K, R57K, H69K, K70E, L89M  
>RCC_TDR_828529| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLENINLSGKWKPKMIGGIGGFIKVKQYD
QILIEICGKEAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190E P225H E6K, V35T, S48T, K49R, V60I, D121Y, K122E, K173R, D177E, R199K, T200M, Q207E, R211K M230I
>RCC_TDR_828529| codons 1-242
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPEIVI
YQYMDDLYVESDLEIGQHKMKIEELREHLLKWGFTTPDKKHQKEHPFLWIGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012