<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RCC_TDR_359957 RCC_TDR_359957 Uganda 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, L19I, E35D, M36I, R41K, Q61N, L63S, I64V, E65D, V77I  
>RCC_TDR_359957| codons 1-99
PQITLWQRPLVAIKIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NISVDICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6R, V35T, T39I, K49R, V60I, D121Y, K122E, D123E, D177E, I178M, V179I, E204K, Q207E  
>RCC_TDR_359957| codons 1-242
PISPIRTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIGQHRTKIEKLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ssemwanga, D Low drug resistance levels among drug-naive individuals with recent HIV-1 infection in a rural clinical cohort in southwestern Uganda. ARHR, 2012