<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7884 CA19929 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 None 61
3 AZT 70
4 DDI+ D4T+ AZT 95
5 DDI+ D4T 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F77FL, N348I     K22KR, R83RK, K166R, T200A, F214L, A272P, K277R, Q278QE, T286A, I293V, P294S, E297A, G333E, Q334H, I341F, K366R, A376AT, T386TI, A400T, T470A, H483Y, E516D, S519N, Q520N, K527N, K530R, A554S  
>CA19929| codons 1-560
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRELCKLLRGAKALTEVVSLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHGQWTYQFYQEPFKILKTGKYARMRGA
HTNDVRQLTEAVQKITTESIVIWGKIPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLADTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESDLVNNIIEQLINKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, I62IV, L63P  
>CA20322| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009