<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7862 CA19899 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+IDV 18
2 None 65
3 D4T+NFV+NVP 61
4 None 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   K20R, K102R, D123E, S134R, Q174R, D177E, T200TP, E204ED, Q207E, R211K, D237DE, D250E F160FS, R206RS
>CA19899| codons 1-254
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPRINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFRKRNPEIVI
YQYMDDLYVASDLEIGQHRPKIEDLSEHLLKWGFTTPDKKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKESWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L63P, I93L  
>CA20291| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005