<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S68G, K122E, D123E, I135V, E138A, S162A, K173T, Q174E, D177E R143RK
>920603JSB| codons 38-195
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSVNNATPGIKYQYNVLPQGWKGSP
AIFQASMTKILEPFRTENPEIVIYQYMDDLYVGSDLEI

References
Author Title Citation
Frange, P Recent HIV-1 infection contributes to the viral diffusion over the French territory with a recent increasing frequency. PLoS ONE, 2012