<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    H51Q, I72V, L101I, T112I, T122I, H171Q, I220L, A265V T124DN
>BAA295906| codons 41-274
DKCQLKGEAMQGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYF
ILKLAGRWPVKIIHTDNGSNFISNTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKK
IIGQVRDQAEQLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKL
QNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQ

References
Author Title Citation
Garrido, C Broad phenotypic cross-resistance to elvitegravir in HIV-infected patients failing on raltegravir-containing regimens. AAC, 2012