<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SD-7 SD-7_36 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ DDI+ IDV 52
3 NFV+ SQV+ ABC+ DDC 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M   L10I, L63P, A71V, I72R, V77I, I93L  
>SD-7_36| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGHKVRGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       P4S, K20KR, K122E, Q174K, I178M, Q207E, R211A, T240TS, A272P, T286A  
>SD-7_36| codons 1-300
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWS
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

References
Author Title Citation
Parkin, NT Loss of antiretroviral drug susceptibility at low viral load during early virological failure in treatment-experienced patients. AIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005