<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, G16E, K20R, E35D, M36I, R41K, Q61H, L63N, C67CY, G68E, H69K, K70R, I72V, L89I  
>RS11000292| codons 5-99
LWQRPLVPVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDHINI
EIYEKRAVGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, D121DY, K122E, D123DEKN, D177DEKN, T200A, Q207A, R211K, V245K, A272P, K281R, T286A, E291D, V292I, I293V, E297K, A304E, E312D  
>RS11000292| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVPLTKEAE
LELEENREILKDPVHGVYYD

References
Author Title Citation
Hassan, A Low prevalence of transmitted HIV-1 drug resistance amongst ARV naive adults in a rural HIV clinic in Kenya. ARHR, 2013