<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SD-1 SD-1_5 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ AZT+ IDV 52
3 NFV+ SQV+ ABC+ D4T 4
4 NFV+ SQV+ ABC+ NVP 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184MV, T215F K219Q Y181YC F227FL V35I, L109X, K122E, V179VI, T200A, I202T, H208Y, R211K, D218E, H221Y, L228H, L283I, R284K, T286TA, E297K V189L
>SD-1_5| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVXDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYLGSDLEIGQHRAKTEELRQYLLKWGFFTPEQKYQKEPPLHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T   L10I, I13V, K20I, E35D, M36I, N37ND, L63P, I66F, A71V  
>SD-1_5| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEFCGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Parkin, NT Loss of antiretroviral drug susceptibility at low viral load during early virological failure in treatment-experienced patients. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012