<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SD-15 SD-15_4 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+DDI NA
2 3TC+AZT+IDV NA
3 NVP+ABC+NFV+SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V   L10V, I62V, L63P, I64V, V77I, I93L  
>SD-15_4| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKAIGTVVIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43Q, S68G, K102KR, V118I, E194EQ, G196GE, E203EK, Q207E, R211K, L228H, K277R, R284RK, T286A, I293V, E297KR  
>SD-15_4| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLQIEQHRTKIKELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVVPLTKEAE

References
Author Title Citation
Parkin, NT Loss of antiretroviral drug susceptibility at low viral load during early virological failure in treatment-experienced patients. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005