<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HPV2_211 HPV2_211 Vietnam 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, E35D, M36I, R41K, H69K, K70R, L89M  
>HPV2_211| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, T107S, K122E, D123S, S162C, K173I, Q174K, D177E, V179I, Q207S, R211S, K223R, V245E  
>HPV2_211| codons 1-260
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVSVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLSWGFTTPDKKHQREPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKL

References
Author Title Citation
Tran, VT No increase of drug-resistant HIV type 1 prevalence among drug-naive individuals in northern Vietnam. ARHR, 2012