<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SD-14 SD-14_16 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ DDI+ IDV 52
3 NFV+ SQV+ ABC+ NVP 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   Y181C, M230L   D177E, H208Y, R211K, L228R, T286A, T296S, E297K  
>SD-14_16| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFRWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLSKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73ST L10I, N37S, R41K, D60E, L63P, I64V, V77I, I93L  
>SD-14_16| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFIKVRQYE
QIPVEICGHKAISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Parkin, NT Loss of antiretroviral drug susceptibility at low viral load during early virological failure in treatment-experienced patients. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005