<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HPC008 HPC008 Vietnam 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12TP, I13V, E35D, M36I, R41K, H69K, L89M  
>HPC008| codons 1-99
PQITLWQRPVVPVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I5V, V35T, T39N, K122E, D123S, I135R, I142V, S162Y, K173R, Q174K, I178M, G196E, Q207S, R211S, K238R, V245E  
>HPC008| codons 1-260
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRRKNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRSHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKL

References
Author Title Citation
Tran, VT No increase of drug-resistant HIV type 1 prevalence among drug-naive individuals in northern Vietnam. ARHR, 2012