<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HPA409 HPA409 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13V, G16E, E35D, M36I, R41K, L63T, H69K, L89I  
>HPA409| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, Q207S, R211N  
>HPA409| codons 1-220
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLNWGFTTPDKK

References
Author Title Citation
Tran, VT No increase of drug-resistant HIV type 1 prevalence among drug-naive individuals in northern Vietnam. ARHR, 2012