<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E V35T, T39D, T69S, W88WG, T107S, K122E, D123S, I135R, S162C, K173AT, Q174K, D177E, Q207S, R211S, K238R, V245E, T286A, E291D, I293V  
>GZ163| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFGEVQLGIPHPAGLKKKKSVSVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEIEI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, G16E, K20I, M36I, R41K, H69K, L89M, Q92K  
>GZ163| codons 1-99
PQITLWQRPLVAVKIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTKIGCTLNF

References
Author Title Citation
Yang, C Transmitted antiretroviral drug resistance and thumb subdomain polymorphisms among newly HIV-1 diagnosed patients infected with CRF01_AE and CRF07_BC virus in Guangdong Province, China ARHR, 2012