<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63T, C67CF, H69K, T74A, L89M, I93L  
>IRL03405| codons 6-98
WQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQITIE
IFGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, D121Y, K122E, A158AS, K173A, D177E, G196K, T200A, Q207E, R211K P150PHQ
>IRL03405| codons 42-235
EKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLQQGWKGSPSIFQ
SSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIKQHRAKIEELREHLLKWGFTTPDKKH
QKEPPFLWMGYELH

References
Author Title Citation
De Gascun, CF Human Immunodeficiency Virus Type 1 in Ireland: Phylogenetic Evidence for Risk Group-Specific Subepidemics. ARHR, 2012