<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IRL32246 IRL32246 Ireland 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12A, L19I, M36I, R41K, L63V, H69K, V77I, L89M, I93L  
>IRL32246| codons 6-98
WQRPMVAIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIVIE
ICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLN

References
Author Title Citation
De Gascun, CF Human Immunodeficiency Virus Type 1 in Ireland: Phylogenetic Evidence for Risk Group-Specific Subepidemics. ARHR, 2012