<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV47HALD LV47HALD Senegal 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, L19S, K20M, M36I, R41K, L63P, H69K, K70R, L89I  
>LV47HALD| codons 1-99
PQITLWQRPLVTVRIGGQSMEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, T39A, S68G, I135V, S162A, T165I, E169Q, K173T, D177E, G196E, T200A, Q207E, V245Q, E248D, V276I, T286A, E291D, V292I, I293V, P294T, S322T, G335D, R356K, M357K, G359S, K366R, T369S, A371V, I375V, A376S, K390R, K395R, T403M  
>LV47HALD| codons 1-421
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILQPFRTQNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLSEVVQKVSTESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
P

References
Author Title Citation
Vergne, L Genetic diversity of protease and reverse transcriptase sequences in non-subtype-B human immunodeficiency virus type 1 strains: evidence of many minor drug resistance mutations in treatment-naive patients. J Clin Microbiol, 2000
Diop-Ndiaye, H Antiretroviral drug resistance mutations in antiretroviral-naive patients from Senegal. ARHR, 2010