<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IRL35854 IRL35854 Ireland 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, K20R, M36I, N37ND, R41RK, L63S, H69K, K70R, L89M  
>IRL35854| codons 6-98
WQRPVVTVKVGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQISIE
ICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K43E, K122E, D123GS, I135T, K173I, Q174K, D177E, I178M, G196GE, Q207A, R211RS K73KR, G213GDE, D218DY, Y232Y*, E233EK
>IRL35854| codons 42-235
EEEGKISKIGPENPYNTPVFAIKKKDSTKWRRLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQ
SSMTKILEPFRIKNPEMVIYQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWEFTTPYKKH
QKEPPFLWMG*KLH

References
Author Title Citation
De Gascun, CF Human Immunodeficiency Virus Type 1 in Ireland: Phylogenetic Evidence for Risk Group-Specific Subepidemics. ARHR, 2012