<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, V75M, M184V, L210W, T215F K219E Y181C A98G E28A, V35T, T39E, K101Q, K122E, D123S, K173I, Q174K, D177E, I178M, T200I, Q207A, R211S, K238R  
>0239RT| codons 16-239
MDGPKVKQWPLTAEKIKALTEICEEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLM
DFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVICQYVDDLYVGSDLEI
GQHRIKIEELRAHLWSWGFFTPDEKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Ferradini, L High efficacy of lopinavir/r-based second-line antiretroviral treatment after 24 months of follow up at ESTHER/Calmette Hospital in Phnom Penh, Cambodia. J Int AIDS Soc, 2011