<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 APV+LPV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V L10F I13V, G16E, E21K, E35D, M36I, R41K, H69K, I72R, L89I  
>0789PR| codons 1-99
PQITLWQRPFVTVKIEGQLKKALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKKARGTVVVGPTPVNVIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219Q Y188L A98G V35T, T39K, E40K, K43E, S68G, K122E, D123S, I135T, T165I, R172K, K173I, Q174K, Q207A, R211S, F214L, D218E, K238R Q182H
>0789RT| codons 16-239
MDGPKVKQWPLTEEKIKALTEICKKMEEEGKISKIGPENPYNTPVFAIKKKGGTRWRKLV
DFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPST
NNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFKIKNPDIVIYHYMDDLLVGSDLEI
GQHRTKIEELRAHLLSWGLTTPEQKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Ferradini, L High efficacy of lopinavir/r-based second-line antiretroviral treatment after 24 months of follow up at ESTHER/Calmette Hospital in Phnom Penh, Cambodia. J Int AIDS Soc, 2011