<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 0739RT Cambodia 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+LPV+TDF 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R K70~, V75M, K219R K103N, Y181C   V35T, T39D, S68N, T69N, K122E, D123S, I135T, K173L, Q174K, D177E, T200A, Q207S, R211S, L228R, K238R  
>0739RT| codons 23-239
QWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPVFAIKRKDNN~WRKLMDFRELNK
RTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVICQYMDDLYVGSDLEIGQHRAKI
EELRSHLLSWGFTTPDRKHQKEPPFRWMGYELHPDRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10V, I13V, G16E, K20R, E35D, M36I, R41K, L63C, H69K, T74A, L89M  
>0739PR| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGAVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Ferradini, L High efficacy of lopinavir/r-based second-line antiretroviral treatment after 24 months of follow up at ESTHER/Calmette Hospital in Phnom Penh, Cambodia. J Int AIDS Soc, 2011