<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+LPV+TDF 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, V75M K70~, K219R K103N, Y181C   V35T, T39D, S68N, T69N, K122E, D123S, I135T, K173L, Q174K, D177E, T200A, Q207S, R211S, L228R, K238R  
>0739RT| codons 23-239
QWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPVFAIKRKDNN~WRKLMDFRELNK
RTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVICQYMDDLYVGSDLEIGQHRAKI
EELRSHLLSWGFTTPDRKHQKEPPFRWMGYELHPDRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10V, I13V, G16E, K20R, E35D, M36I, R41K, L63C, H69K, T74A, L89M  
>0739PR| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGAVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Ferradini, L High efficacy of lopinavir/r-based second-line antiretroviral treatment after 24 months of follow up at ESTHER/Calmette Hospital in Phnom Penh, Cambodia. J Int AIDS Soc, 2011