<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 FTC+NVP+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V   Y181C, G190GA A98G E6D, T27S, V35T, T39K, K43E, V111I, K122E, D123S, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E, T286A, E291D, V292I, I293V, E312T, P313T, I326V, I329V  
>PHPT4484PR-RT| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLSEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVASDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTTVHGVYYDPSKDLVAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, I72V, L89M  
>PHPT4484PR-RT| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ngo-Giang-Huong, N Resistance patterns selected by nevirapine vs. efavirenz in HIV-infected patients failing first-line antiretroviral treatment: A bayesian analysis. PLoS ONE, 2011